PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_25906.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB
Protein Properties Length: 340aa    MW: 37829.2 Da    PI: 4.974
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_25906.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.44.4e-105395347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT eE e + +  + +G++ +++I++ ++ ++t  +c+++++ky
     MLOC_25906.3 53 PWTHEEKEVFMQMLASFGKN-FSKISNFLQ-HKTIADCVEFYYKY 95
                     8*****************99.*********.*************9 PP

2Myb_DNA-binding223.9e-07264305346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       W   E  l+++a + +G++ +++I++++   ++ +qck ++ k
     MLOC_25906.3 264 DWNDNEKSLFIEALNNHGKD-FARISSYVK-SKSYEQCKVFFSK 305
                      5999**************99.********9.********88765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-153698IPR009057Homeodomain-like
PROSITE profilePS5129314.02849100IPR017884SANT domain
SMARTSM007172.7E-85098IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-75297IPR009057Homeodomain-like
PfamPF002497.2E-85295IPR001005SANT/Myb domain
PROSITE profilePS5129314.846260311IPR017884SANT domain
SMARTSM007176.9E-5261309IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-4264304IPR009057Homeodomain-like
PfamPF002493.4E-6264304IPR001005SANT/Myb domain
SuperFamilySSF466892.34E-9264306IPR009057Homeodomain-like
CDDcd001677.49E-5265303No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MFTEFQFKRC RNYLKMPALI IDEKEKESAS FVSKNGLIED PVSVEKERSV INPWTHEEKE  60
VFMQMLASFG KNFSKISNFL QHKTIADCVE FYYKYHKSDS FREVKKLLDL RQQQPTSNYL  120
GSNSGKKWNP ENAASLDMLG NAASVVATHG LDYANRVEKD TAKSIIRTSC RSDVSAVAKG  180
SLDRDGIANV SLHERESVAA DVLAGICGTL SPEGMGSCIT SSADHGQKIG ATRMDYLMTT  240
PEADKSFDEE DTLSDQECEV DSVDWNDNEK SLFIEALNNH GKDFARISSY VKSKSYEQCK  300
VFFSKARISL GLDLIYQRTT DVGLPTGDAN GGTSDTDEAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D8e-1711102494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C8e-1711102494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231802.10.0PREDICTED: uncharacterized protein LOC100825285
TrEMBLM0VFC80.0M0VFC8_HORVD; Uncharacterized protein
STRINGMLOC_25906.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.14e-66MYB family protein